Tmem106b antibody
WebJul 16, 2024 · TMEM106B is a novel driver of invasion and metastasis in lung cancers. a Primary tumor growth for 393P cells overexpressing individual hits (as indicated), identified in the in vivo screen 5 were ... WebTarget Information. Transmembrane protein 106B (TMEM106B) is a single-pass transmembrane protein that is thought to be a novel risk factor for frontotemporal lobar degeneration (FTLD), a group of clinically, pathologically and genetically heterogeneous disorders associated with atrophy in the frontal lobe and temporal lobe of the brain.
Tmem106b antibody
Did you know?
WebTmem106b(71900) Description 免疫原 The immunogen for anti-TMEM106B antibody: synthetic peptide derected towards the C terminal of human TMEM106B 包装 100 μL 50 μg 序列 Synthetic peptide located within the following region: AEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDC 外形 WebAnti-TMEM106B antibody (ab244516) is not available We are sorry, ab244516 has been discontinued. We apologize for the inconvenience. You can still access the archived …
WebTMEM106B antibody LS-C661069 is an unconjugated mouse monoclonal antibody to human TMEM106B. Validated for ELISA and WB. Target. Human TMEM106B. Synonyms. TMEM106B Transmembrane protein 106B. See All TMEM106B Antibodies. Host. Mouse. Reactivity. Human (tested or 100% immunogen sequence identity) Clonality ... WebTransmembrane protein 106B (TMEM106B) is a single-pass type II membrane protein present in endosomal and lysosomal membranes, and is highly expressed in the frontal …
WebThis TMEM106B antibody is un-conjugated Application All applications for TMEM106B antibodies Western Blotting (WB) Cross-Reactivity Mouse (Murine) Purification Purified Immunogen Tmem106 b antibody was raised in rabbit using the C terminal of Tmem106 as the immunogen Alternatives (show) Application Details (hide) Application Notes WebTransmembrane protein 106B (TMEM106B) is a type II transmembrane protein with unknown function (1). TMEM106B was first identified as a major risk factor in genome …
WebAnti-TMEM106B Antibody, clone TME-N 6F2. MABN473 is a primary antibody from MilliporeSigma. 3 Citations Host: Rat Clonality: Monoclonal (TME-N 6F2) Validations: None Available Applications: WB and IF. Reactivity: Homo sapiens (Human) and Rattus norvegicus (Rat) TMEM106B Antibody.
WebDec 17, 2024 · Validation of TMEM106B C-terminal antibodies. The SB0051 antibody demonstrated positive IHC staining of sections of frontal cortex from cases that had previously been found to have abundant TMEM106B (120-254) filaments by cryo-EM, but did not stain sections from cases in which TMEM106B filaments were either not isolated or … farm shop newtown linfordWebDescription. TMEM106B antibody LS-C757550 is an unconjugated rabbit polyclonal antibody to TMEM106B (C-Terminus) from human. It is reactive with human and mouse. … freeserial youWebTMEM106B Antibody Summary Applications/Dilutions Packaging, Storage & Formulations Notes The addition of 50% glycerol is optional for those storing this antibody at -20C and … farm shop new miltonWebTMEM106B: Protein_name: T106B: Human swiss prot no: 54664: Human swiss prot no: Q9NUM4: Mouse gene id: 71900: Mouse swiss prot no: Q80X71: Rat gene id: 312132: Rat swiss prot no: Q6AYA5: ... The antibody was affinity-purified from rabbit serum by affinity-chromatography using specific immunogen. Concentration: farm shop newport shropshireWebProteintech Anti-TMEM106B Polyclonal, Catalog # 20995-1-AP. Tested in Western Blot (WB), Immunocytochemistry (ICC/IF), Immunohistochemistry (Paraffin) (IHC (P)) and … farm shop newquayfree serien online streamWebAug 15, 2012 · TMEM106B, the risk gene for frontotemporal dementia, is regulated by the microRNA-132/212 cluster and affects progranulin pathways Frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP) is a fatal neurodegenerative disease with no available treatments. freeseries cc